PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009629413.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CO-like
Protein Properties Length: 373aa    MW: 41758.6 Da    PI: 5.4549
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009629413.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.11.5e-071659239
        zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                    ++r C+ ++e+ + l+C+ ++  lC +C  e H+       Ht+
  XP_009629413.1 16 QKRLCDFCGENTALLYCRADSAKLCFSCDREVHSTnqlftkHTR 59
                    6899*****************************66778888875 PP

2zf-B_box20.51e-0662104542
        zf-B_box   5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                      C+ +++ ++++ C ++++ +C++C  e+H +      H+++pl
  XP_009629413.1  62 LCDSCDSSPASILCCTDSCVFCQNCDWESH-NlslspaHERRPL 104
                     6*****************************.6688999988775 PP

3CCT60.74.7e-21327369143
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                     Re a++RYkeK+ktR++eK+irY sRK++AesR R+KGrF+k 
  XP_009629413.1 327 RETAVSRYKEKKKTRRYEKHIRYVSRKVRAESRTRIKGRFAKM 369
                     99***************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.0821562IPR000315B-box-type zinc finger
SMARTSM003361.2E-131562IPR000315B-box-type zinc finger
PfamPF006433.7E-61659IPR000315B-box-type zinc finger
CDDcd000211.74E-71859No hitNo description
PROSITE profilePS501199.65558104IPR000315B-box-type zinc finger
CDDcd000217.56E-562104No hitNo description
SMARTSM003360.4663104IPR000315B-box-type zinc finger
PROSITE profilePS5101714.515327369IPR010402CCT domain
PfamPF062032.9E-15327369IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MTELKEDQED QNQQPQKRLC DFCGENTALL YCRADSAKLC FSCDREVHST NQLFTKHTRW  60
LLCDSCDSSP ASILCCTDSC VFCQNCDWES HNLSLSPAHE RRPLEGFTGC PSVSELLSIL  120
GFEDLGKKAL LYGDSVTSDG GGYGFSDWLV WDTPSVVSLD DLIAPNDSGH NFQAIGVPPL  180
PKNRNAACGK HKEEILCQLR ELSKLEPNSS DDQDDIVAFQ FMEPAQNRQL GFKGSGFMQN  240
SEHAVVPSSE GSAFNWCSDT GKITDQGFSS SLADCFIETK CLLPDRDSDV GDASGGANEE  300
RSHNPPIADT FQMVPKVAHR ELNSQERETA VSRYKEKKKT RRYEKHIRYV SRKVRAESRT  360
RIKGRFAKMD MHQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629413.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 13 isoform X2
TrEMBLM1AT270.0M1AT27_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000295910.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47890.11e-85B-box type zinc finger protein with CCT domain